- Integrin alpha 2b/CD41 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84580
- Integrin alpha 2b/CD41
- 0.1 ml (also 25ul)
- BDPLT16, BDPLT2, CD41, CD41B, GP2B, GPIIb, GT, GT1, GTA, HPA3, PPP1R93
- This antibody was developed against Recombinant Protein corresponding to amino acids: FGFSLDFHKD SHGRVAIVVG APRTLGPSQE ETGGVFLCPW RAEGGQCPSL LFDLRDETRN V
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- integrin subunit alpha 2b
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Angiogenesis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Immunology, Signal Transduction, Stem Cell Markers
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
Specifications/Features
Available conjugates: Unconjugated